![]() |
BEAUTY (BLAST Enhanced Alignment Utility) is an enhanced version of the BLAST sequence database search tool. See the BEAUTY Help Page for a more detailed program description, as well as a description of the Protein Family and Conserved Regions databases used in this program. Provided by the Human Genome Sequencing Center, Baylor College of Medicine.
Reference:
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
Reference: Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72. Altschul, Stephen F., Warren Gish, Webb Miller, Eugene W. Myers, and David J. Lipman (1990). Basic local alignment search tool. J. Mol. Biol. 215:403-10.
Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= query (956 letters)
EchoFilter:
Translating both strands of query sequence in all 6 reading framesDatabase: /local/dot5/sl_home/beauty/seqdb/blast-db/CRSeqAnnot.fa 78,469 sequences; 28,902,124 total letters.
WARNING: -hspmax 100 was exceeded with 1 of the database sequences, with as many as 101 HSPs being found at one time.
Histogram:
Observed Numbers of Database Sequences Satisfying
Various EXPECTation Thresholds (E parameter values)
Histogram units: = 17 Sequences : less than 17 sequences
EXPECTation Threshold
(E parameter)
|
V Observed Counts-->
10000 3138 1002 |==========================================================
6310 2136 578 |==================================
3980 1558 552 |================================
2510 1006 299 |=================
1580 707 239 |==============
1000 468 134 |=======
631 334 104 |======
398 230 76 |====
251 154 46 |==
158 108 38 |==
100 70 25 |=
63.1 45 8 |:
>>>>>>>>>>>>>>>>>>>>> Expect = 50.0, Observed = 42 <<<<<<<<<<<<<<<<<
39.8 37 10 |:
25.1 27 9 |:
15.8 18 8 |:
10.0 10 2 |:
6.31 8 2 |:
3.98 6 1 |:
2.51 5 0 |
1.58 5 1 |:
1.00 4 0 |
0.63 4 0 |
0.40 4 0 |
0.25 4 0 |
0.16 4 0 |
0.10 4 0 |
0.063 4 0 |
0.040 4 0 |
0.025 4 0 |
0.016 4 0 |
0.010 4 0 |
0.0063 4 0 |
0.0040 4 0 |
0.0025 4 1 |:
Smallest
Sum
Reading High Probability
Sequences producing High-scoring Segment Pairs: Frame Score P(N) N
sp|P06978|PGSA CDP-DIACYLGLYCEROL--GLYCEROL-3-PHOSPHATE 3-PH +1 945 3.6e-126 1
gi|472401 phosphatidylglycerophosphate synthase +1 400 6.0e-66 3
gi|467087 +1 142 6.0e-18 3
sp|P06197|PIS_ CDP-DIACYLGLYCEROL--INOSITOL 3-PHOSPHATIDYLTR +1 91 0.0019 1
sp|P37924|FIMD FIMD PROTEIN PRECURSOR. +3 63 0.67 3
sp|P37730|AMYD POTENTIAL STARCH DEGRADATION PRODUCTS TRANSPO +1 69 0.94 1
gi|525287 aminopeptidase N. -2 59 0.997 2
gi|532271 phosphatidylserine synthase +1 66 0.998 1
sp|P30343|MER3 MERCURY RESISTANCE OPERON ORF3. -2 66 0.998 1
gi|461402 methyltransferase -3 56 0.99992 2
bbs|140965|gi| wingless protein=wg/wingless wgIL114 [Drosoph +1 45 0.99996 3
pir||S32661|gi OAC2 protein - Azorhizobium caulinodans -2 65 0.99996 1
bbs|114265|gi| lincomycin-resistance determinant LmrB=23S rR -2 56 0.99999 2
gi|581701 methyltransferase -2 56 0.99999 2
sp|P18175|INVO INVOLUCRIN. -3 57 0.99999 2
gi|581699 bases 361..1197 in X62867 -2 56 0.99999 2
pir||S33978|gi hypothetical protein - African clawed frog tr -3 44 0.99999 3
sp|P15586|GL6S N-ACETYLGLUCOSAMINE-6-SULFATASE PRECURSOR (G6 +2 49 0.999999 3
gi|457707 CshA protein -2 64 1.000000 1
gi|577742 C09G5.6, similar to Collagen -1 44 1.000000 4
sp|P20715|HMDH 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTA +1 58 1.000000 2
sp|P22726|WN5B WNT-5B PROTEIN PRECURSOR. +2 49 1.000000 3
sp|P15822|ZEP1 ZINC FINGER PROTEIN 40 (HUMAN IMMUNODEFICIENC -3 57 1.000000 2
sp|Q05556|CPAB CYTOCHROME P450 IIA11 (P450-IIA11). +1 63 1.000000 1
sp|P16766|UL35 HYPOTHETICAL PROTEIN UL35. -2 63 1.000000 1
sp|P09615|WNTG PROTEIN DINT-1 PRECURSOR (WINGLESS PROTEIN). +3 43 1.000000 3
bbs|140967|gi| wingless protein=wg/wingless wgIN67 [Drosophi +3 43 1.000000 3
sp|P35503|UD1C UDP-GLUCURONOSYLTRANSFERASE 1C PRECURSOR, MIC -2 52 1.000000 2
sp|P00744|PRTZ VITAMIN K-DEPENDENT PROTEIN Z. -3 45 1.000000 3
sp|P09346|KNOB KNOB-ASSOCIATED HISTIDINE-RICH PROTEIN PRECUR -3 59 1.000000 2
sp|P13818|KNOB KNOB-ASSOCIATED HISTIDINE-RICH PROTEIN PRECUR -3 59 1.000000 2
gi|488833 zinc finger protein 51 -3 50 1.000000 3
prf||1705218D| Wnt-6 gene +3 47 1.000000 3
gi|347377 MLL-AF4 der(11) fusion protein -2 46 1.000000 3
gi|443822 H,K-ATPase +1 44 1.000000 3
gi|218415 phosphatidylserine synthase +1 61 1.000000 1
gi|530088 aminoalcoholphosphotransferase +1 61 1.000000 1
gi|580702 fixP +2 54 1.000000 2
sp|P10327|CRYW 130 KD CRYSTAL PROTEIN (DELTA ENDOTOXIN) (CRY -3 61 1.000000 1
gi|490199 lepidoptera larvicidal protein -3 61 1.000000 1
gi|291529 tegument protein -2 61 1.000000 1
sp|P31287|WNT6 XWNT-6 PROTEIN. +3 44 1.000000 2
Locally-aligned regions (HSPs) with respect to frame 3 of query sequence:
Locus_ID Clus_ID
sp|P37924|FIMD 634.21 | _________
bbs|140965|gi| | ___
sp|P22726|WN5B 76.92 | __
sp|P09615|WNTG 546.24 | ___
bbs|140967|gi| | ___
prf||1705218D| 76.93 | _____
gi|443822 217.45 | ___
sp|P31287|WNT6 76.93 | ______ _____
sp|P31287|WNT6 76.93 | ______ _____
Prosite Hits: _____
__________________________________________________
Query sequence: | | | | | | | | 318
0 50 100 150 200 250 300
__________________
Prosite hits:
LEUCINE_ZIPPER Leucine zipper pattern. 179..200
__________________
Locally-aligned regions (HSPs) with respect to frame 2 of query sequence:
Locus_ID Clus_ID
sp|P37924|FIMD 634.21 | ____
bbs|140965|gi| | ___
sp|P15586|GL6S 4462.4 | ____ _____
sp|P15586|GL6S 4462.4 | ____ _____
sp|P20715|HMDH 339.35 | ____
sp|P22726|WN5B 76.92 | ___
sp|P09615|WNTG 546.24 | ___
bbs|140967|gi| | ___
prf||1705218D| 76.93 | ___
gi|580702 4770 | __ ____
gi|580702 4770 | __ ____
Prosite Hits: _____
__________________________________________________
Query sequence: | | | | | | | | 318
0 50 100 150 200 250 300
__________________
Prosite hits:
LEUCINE_ZIPPER Leucine zipper pattern. 179..200
__________________
Locally-aligned regions (HSPs) with respect to frame 1 of query sequence:
Locus_ID Clus_ID
sp|P06978|PGSA 7579 | _____________________________
gi|472401 7579 | ___________________ ___ ____
gi|472401 7579 | ___________________ ___ ____
gi|472401 7579 | ___________________ ___ ____
gi|467087 7579 | _____________ _____
gi|467087 7579 | _____________ _____
gi|467087 7579 | _____________ _____
sp|P06197|PIS_ | __________
sp|P37924|FIMD 634.21 | ___
sp|P37730|AMYD 5749.3 | _____
gi|532271 | ________
bbs|140965|gi| | ____
sp|P15586|GL6S 4462.4 | ___
sp|P20715|HMDH 339.35 | ______
sp|P22726|WN5B 76.92 | __
sp|Q05556|CPAB 167.59 | _________
sp|P09615|WNTG 546.24 | ____
bbs|140967|gi| | ____
prf||1705218D| 76.93 | ___
gi|443822 217.45 | ______ _______
gi|443822 217.45 | ______ _______
gi|218415 | ________
gi|530088 4944.3 | ________
Prosite Hits: _____
__________________________________________________
Query sequence: | | | | | | | | 318
0 50 100 150 200 250 300
__________________
Prosite hits:
LEUCINE_ZIPPER Leucine zipper pattern. 179..200
__________________
Locally-aligned regions (HSPs) with respect to frame -1 of query sequence:
Locus_ID Clus_ID
gi|525287 635.21 | ____
gi|577742 | _____
sp|P35503|UD1C 1040.14| _____
sp|P00744|PRTZ 3591.3 | ____
gi|347377 | _____
Prosite Hits: _____
__________________________________________________
Query sequence: | | | | | | | | 318
0 50 100 150 200 250 300
__________________
Prosite hits:
LEUCINE_ZIPPER Leucine zipper pattern. 179..200
__________________
Locally-aligned regions (HSPs) with respect to frame -2 of query sequence:
Locus_ID Clus_ID
gi|525287 635.21 | ________
sp|P30343|MER3 | _______
gi|461402 2586.7 | ______
pir||S32661|gi 2200.8 | ______
bbs|114265|gi| 2933.6 | _______ _____
bbs|114265|gi| 2933.6 | _______ _____
gi|581701 2933.6 | _______ _____
gi|581701 2933.6 | _______ _____
gi|581699 2933.6 | _______ _____
gi|581699 2933.6 | _______ _____
pir||S33978|gi | _________
gi|457707 | ______
gi|577742 | ______ ___
gi|577742 | ______ ___
sp|P16766|UL35 | _____________
sp|P35503|UD1C 1040.14| _____
sp|P09346|KNOB | ___
sp|P13818|KNOB | ___
gi|347377 | ____
gi|291529 7006.2 | _______
Prosite Hits: _____
__________________________________________________
Query sequence: | | | | | | | | 318
0 50 100 150 200 250 300
__________________
Prosite hits:
LEUCINE_ZIPPER Leucine zipper pattern. 179..200
__________________
Locally-aligned regions (HSPs) with respect to frame -3 of query sequence:
Locus_ID Clus_ID
gi|461402 2586.7 |____
sp|P18175|INVO 5789.3 | ______________
sp|P18175|INVO 5789.3 | ______________
sp|P18175|INVO 5789.3 | ______________
pir||S33978|gi | ___ ______
pir||S33978|gi | ___ ______
gi|577742 | _____
sp|P15822|ZEP1 1302.12| _____ ______
sp|P15822|ZEP1 1302.12| _____ ______
sp|P00744|PRTZ 3591.3 | ________ ____
sp|P00744|PRTZ 3591.3 | ________ ____
sp|P09346|KNOB | _______
sp|P13818|KNOB | _______
gi|488833 28.141 | _____ ____ ____
gi|488833 28.141 | _____ ____ ____
gi|488833 28.141 | _____ ____ ____
gi|347377 | ______
sp|P10327|CRYW 198.53 | ___
gi|490199 198.53 | ___
Prosite Hits: _____
__________________________________________________
Query sequence: | | | | | | | | 318
0 50 100 150 200 250 300
__________________
Prosite hits:
LEUCINE_ZIPPER Leucine zipper pattern. 179..200
__________________
Note:In the alignments click on Use the
and
icons to retrieve links to Entrez:
sp|P06978|PGSA_ECOLI|gi|548498 CDP-DIACYLGLYCEROL--GLYCEROL-3-PHOSPHATE 3-PHOSPHATIDYLTRANSFERASE (PHOSPHATIDYLGLYCEROPHOSPHATE SYNTHASE) (PGP SYNTHASE). Length = 182 Cluster: 7579 cdp-diacylglycerol--glycerol-3-phosphate mycobacterium 3-phosphatidyltransferase leprae phosphatidylglycerophosphate synthase pgp Conserved regions: Cluster 7579 |_____ _________ ___ | Local hits (HSPs): __________________________________________________ Annotated Domains: _ ______________________________________________ __________________________________________________ Database sequence: | | | | | 182 0 50 100 150 __________________ Annotated Domains: Entrez pyrrolidone-carboxylic-acid site 2 Entrez Transmembrane region 14..38 Entrez Transmembrane region 62..82 Entrez Transmembrane region 88..108 Entrez Transmembrane region 147..169 PFAM CDP-OH_P_transf: CDP-alcohol phosphatidy 35..177 BLOCKS BL00379: CDP-alcohol phosphatidyltransfe 45..81 PROSITE CDP_ALCOHOL_P_TRANSF: CDP-alcohol phosph 49..71 __________________ Plus Strand HSPs: Score = 945 (434.7 bits), Expect = 3.6e-126, P = 3.6e-126 Identities = 182/182 (100%), Positives = 182/182 (100%), Frame = +1 Query: 82 MQFNIPTLLTLFRVILIPFFVLVFYLPVTWSPFAAALIFCVAAVTDWFDGFLARRWNQST 261 MQFNIPTLLTLFRVILIPFFVLVFYLPVTWSPFAAALIFCVAAVTDWFDGFLARRWNQST Sbjct: 1 MQFNIPTLLTLFRVILIPFFVLVFYLPVTWSPFAAALIFCVAAVTDWFDGFLARRWNQST 60 Query: 262 RFGAFLDPVADKVLVAIAMVLVTEHYHSWWVTLPAATMIAREIIISALREWMAELGKRSS 441 RFGAFLDPVADKVLVAIAMVLVTEHYHSWWVTLPAATMIAREIIISALREWMAELGKRSS Sbjct: 61 RFGAFLDPVADKVLVAIAMVLVTEHYHSWWVTLPAATMIAREIIISALREWMAELGKRSS 120 Query: 442 VAVSWIGKVKTTAQMVALAWLLWRPNIWVEYAGIALFFVAAVLTLWSMLQYLSAARADLL 621 VAVSWIGKVKTTAQMVALAWLLWRPNIWVEYAGIALFFVAAVLTLWSMLQYLSAARADLL Sbjct: 121 VAVSWIGKVKTTAQMVALAWLLWRPNIWVEYAGIALFFVAAVLTLWSMLQYLSAARADLL 180 Query: 622 DQ 627 DQ Sbjct: 181 DQ 182
gi|472401 phosphatidylglycerophosphate synthase Length = 195 Cluster: 7579 cdp-diacylglycerol--glycerol-3-phosphate mycobacterium 3-phosphatidyltransferase leprae phosphatidylglycerophosphate synthase pgp Conserved regions: Cluster 7579 |____ _________ ___ | Local hits (HSPs): ______________________________ _____ ______ __________________________________________________ Database sequence: | | | | | 195 0 50 100 150 Plus Strand HSPs: Score = 400 (184.0 bits), Expect = 6.0e-66, Sum P(3) = 6.0e-66 Identities = 72/114 (63%), Positives = 93/114 (81%), Frame = +1 Query: 91 NIPTLLTLFRVILIPFFVLVFYLPVTWSPFAAALIFCVAAVTDWFDGFLARRWNQSTRFG 270 NIP L+T+ RV+LIP F+L+FYLP WS AA+ +F AA TDW DG+LARR QST FG Sbjct: 2 NIPNLITVLRVLLIPIFILLFYLPYNWSYMAASSVFAFAAATDWLDGYLARRLEQSTPFG 61 Query: 271 AFLDPVADKVLVAIAMVLVTEHYHSWWVTLPAATMIAREIIISALREWMAELGK 432 AFLDPVADK++VA+A+VL+ + + + W+TLPAA +I REI++SALREWMAELG+ Sbjct: 62 AFLDPVADKLMVAVALVLLVQEHGNLWLTLPAAVIIGREIVVSALREWMAELGR 115 Score = 73 (33.6 bits), Expect = 6.0e-66, Sum P(3) = 6.0e-66 Identities = 15/23 (65%), Positives = 16/23 (69%), Frame = +1 Query: 538 GIALFFVAAVLTLWSMLQYLSAA 606 G A +A LTLWSMLQYL AA Sbjct: 154 GYAFLLIAGGLTLWSMLQYLRAA 176 Score = 42 (19.3 bits), Expect = 6.0e-66, Sum P(3) = 6.0e-66 Identities = 10/16 (62%), Positives = 11/16 (68%), Frame = +1 Query: 469 KTTAQMVALAWLLWRP 516 KT AQM+AL LL P Sbjct: 129 KTAAQMLALVILLANP 144
gi|467087 Length = 193 Cluster: 7579 cdp-diacylglycerol--glycerol-3-phosphate mycobacterium 3-phosphatidyltransferase leprae phosphatidylglycerophosphate synthase pgp Conserved regions: Cluster 7579 |____ _________ ___ | Local hits (HSPs): ______ _____________ _______ __________________________________________________ Database sequence: | | | | | 193 0 50 100 150 Plus Strand HSPs: Score = 142 (65.3 bits), Expect = 6.0e-18, Sum P(3) = 6.0e-18 Identities = 26/47 (55%), Positives = 35/47 (74%), Frame = +1 Query: 181 AAALIFCVAAVTDWFDGFLARRWNQSTRFGAFLDPVADKVLVAIAMV 321 AA +IF VA +TD DG LARR+ +T FGAF+DP+ADK L+ A++ Sbjct: 42 AAFVIFTVACITDRLDGLLARRYGMATEFGAFVDPIADKTLIGAALI 88 Score = 54 (24.8 bits), Expect = 6.0e-18, Sum P(3) = 6.0e-18 Identities = 11/25 (44%), Positives = 14/25 (56%), Frame = +1 Query: 433 RSSVAVSWIGKVKTTAQMVALAWLL 507 R + SW GK+KT Q VA+ L Sbjct: 121 RGVIPASWGGKLKTVVQAVAIGLFL 145 Score = 45 (20.7 bits), Expect = 6.0e-18, Sum P(3) = 6.0e-18 Identities = 7/22 (31%), Positives = 15/22 (68%), Frame = +1 Query: 91 NIPTLLTLFRVILIPFFVLVFY 156 N+ +LT R++L+P F++ + Sbjct: 9 NLANILTGLRLMLVPVFLVALF 30
sp|P06197|PIS_YEAST|gi|130240 CDP-DIACYLGLYCEROL--INOSITOL 3-PHOSPHATIDYLTRANSFERASE (PHOSPHATIDYLINOSITOL SYNTHASE). Length = 220 Local hits (HSPs): ______________ Annotated Domains: _ _____________________________________ _ __________________________________________________ Database sequence: | | | | | | 220 0 50 100 150 200 __________________ Annotated Domains: Entrez glycosylation site 4 Entrez glycosylation site 217 PFAM CDP-OH_P_transf: CDP-alcohol phosphatidy 46..205 BLOCKS BL00379: CDP-alcohol phosphatidyltransfe 56..92 PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 120..127 PROSITE CDP_ALCOHOL_P_TRANSF: CDP-alcohol phosph 59..81 __________________ Plus Strand HSPs: Score = 91 (41.9 bits), Expect = 0.0019, P = 0.0019 Identities = 20/60 (33%), Positives = 30/60 (50%), Frame = +1 Query: 175 PFAAALIFCVAAVTDWFDGFLARRWNQSTRFGAFLDPVADKVLVAIAMVLVTEHYHSWWV 354 P A ++ + + D DG +AR++NQ + GA LD V D+ A M + Y W V Sbjct: 42 PTAFTWLYSTSCLLDALDGTMARKYNQVSSLGAVLDMVTDRSSTAGLMCFLCVQYPQWCV 101
sp|P37924|FIMD_SALTY|gi|585135 FIMD PROTEIN PRECURSOR. Length = 870 Cluster: 634.11 cg fimd focd fimbrial protein site s adhesin no precursor Cluster: 634.21 cs6 fimd capsule f1 site subunits usher protein synthesis precursor Conserved regions: Cluster 634.11 |___ __ ________ ______ __ __ _ _________| Cluster 634.21 |_________ _________| Local hits (HSPs): __ __ ____ Annotated Domains: _______________________________________________ __________________________________________________ Database sequence: | | | | | | | 870 0 150 300 450 600 750 __________________ Annotated Domains: PFAM Usher: Fimbrial Usher proteins 38..850 BLOCKS BL01151: Fimbrial biogenesis outer membr 260..314 PROSITE FIMBRIAL_USHER: Fimbrial biogenesis oute 314..324 PROSITE TYR_PHOSPHO_SITE: Tyrosine kinase phosph 191..198 PROSITE TYR_PHOSPHO_SITE: Tyrosine kinase phosph 484..491 __________________ Plus Strand HSPs: Score = 63 (29.0 bits), Expect = 1.1, Sum P(3) = 0.67 Identities = 14/47 (29%), Positives = 24/47 (51%), Frame = +3 Query: 804 STTLPRSGSRVRVSFPAPV*KTSASSGCLAERPEEFGALTKRLCSGL 944 S+ +P G+ VR +F + + + L RP FGA+ + SG+ Sbjct: 764 SSVVPTEGALVRAAFDTRIGVRAIITARLGGRPLPFGAIVRETASGI 810 Score = 39 (17.9 bits), Expect = 1.1, Sum P(3) = 0.67 Identities = 6/16 (37%), Positives = 11/16 (68%), Frame = +2 Query: 398 LRYANGWRSWVNAVAW 445 L YA+GW+ +++W Sbjct: 554 LGYASGWQGISYSLSW 569 Score = 36 (16.6 bits), Expect = 1.1, Sum P(3) = 0.67 Identities = 5/9 (55%), Positives = 8/9 (88%), Frame = +1 Query: 226 DGFLARRWN 252 DG+ ++RWN Sbjct: 225 DGYHSQRWN 233
sp|P37730|AMYD_THETU|gi|584757 POTENTIAL STARCH DEGRADATION PRODUCTS TRANSPORT SYSTEM PERMEASE PROTEIN AMYD. Length = 292 Cluster: 5749.3 potential sn-glycerol-3-phosphate starch sugar-binding transport products system protein permease ugpa Conserved regions: Cluster 5749.3 | _______ ___ __ | Local hits (HSPs): ______ Annotated Domains: ____ ____ _____ ______________________ __________________________________________________ Database sequence: | | | | | | | 292 0 50 100 150 200 250 __________________ Annotated Domains: Entrez Transmembrane region 15..35 Entrez Transmembrane region 77..97 Entrez Transmembrane region 110..130 Entrez Transmembrane region 156..176 Entrez Transmembrane region 205..225 Entrez Transmembrane region 260..280 PFAM BPD_transp: Binding-protein-dependent tr 178..255 BLOCKS BL00402A: Binding-protein-dependent tran 16..29 BLOCKS BL00402B: Binding-protein-dependent tran 188..207 PROSITE BPD_TRANSP_INN_MEMBR: Binding-protein-de 179..207 __________________ Plus Strand HSPs: Score = 69 (31.7 bits), Expect = 2.8, P = 0.94 Identities = 13/29 (44%), Positives = 19/29 (65%), Frame = +1 Query: 88 FNIPTLLTLFRVILIPFFVLVFYLPVTWS 174 F PTLL+L V+LIPF + ++Y W+ Sbjct: 17 FIAPTLLSLIIVVLIPFIIGIYYSFTDWN 45
gi|525287 aminopeptidase N. Length = 963 Cluster: 635.17 thyrotropin-releasing aminopeptidase microsomal n type ec 3.4.11.2 membrane protein rabbits Cluster: 635.21 aminopeptidase yscii lysyl microsomal n a ec lys-ap protein membrane Conserved regions: Cluster 635.17 |________________ __ _ ___ _ _ __ | Cluster 635.21 |________________ | Local hits (HSPs): __ ___ __________________________________________________ Database sequence: | | | | | | | | 963 0 150 300 450 600 750 900 Minus Strand HSPs: Score = 59 (27.1 bits), Expect = 5.8, Sum P(2) = 1.0 Identities = 12/47 (25%), Positives = 26/47 (55%), Frame = -2 Query: 700 YLAR*VNDIFHHF*SFAENYAETITDQANLHAQRSNIATLTTESVPQ 560 YL + V +F HF + +N+ E + + +++ + I+T + +PQ Sbjct: 718 YLRKQVEPLFQHFETLTKNWTERPENLMDQYSEINAISTACSNGLPQ 764 Score = 44 (20.2 bits), Expect = 5.8, Sum P(2) = 1.0 Identities = 8/16 (50%), Positives = 9/16 (56%), Frame = -1 Query: 824 RPWQGRALPTELFPHS 777 +PW LPT L P S Sbjct: 65 KPWNRYRLPTTLLPDS 80
gi|532271 phosphatidylserine synthase Length = 177 Local hits (HSPs): _____________ __________________________________________________ Database sequence: | | | | | 177 0 50 100 150 Plus Strand HSPs: Score = 66 (30.4 bits), Expect = 6.3, P = 1.0 Identities = 16/45 (35%), Positives = 21/45 (46%), Frame = +1 Query: 181 AAALIFCVAAVTDWFDGFLARRWNQSTRFGAFLDPVADKVLVAIA 315 +A L D+FDG AR+ N + G LD AD V +A Sbjct: 30 SAVLFIFTGMFLDFFDGMAARKLNAVSDMGRELDSFADLVTFGVA 74
sp|P30343|MER3_STRLI|gi|266525 MERCURY RESISTANCE OPERON ORF3. Length = 189 Local hits (HSPs): ____________ Annotated Domains: ___ ____ __________________________________________________ Database sequence: | | | | | 189 0 50 100 150 __________________ Annotated Domains: PROSITE PROKAR_LIPOPROTEIN: Prokaryotic membrane 24..34 PROSITE PROKAR_LIPOPROTEIN: Prokaryotic membrane 75..85 __________________ Minus Strand HSPs: Score = 66 (30.4 bits), Expect = 6.5, P = 1.0 Identities = 16/43 (37%), Positives = 21/43 (48%), Frame = -2 Query: 625 DQANLHAQRSNIATLTTESVPQPQRKVQYRRTQPKCSDATAAM 497 D+ +QR +A L+T V PQ KV YR T P A+ Sbjct: 142 DKGAALSQRYQVAALSTLIVVAPQGKVTYRATDPSADQIQDAL 184
gi|461402 methyltransferase Length = 492 Cluster: 2586.5 chemotaxis cher hypothetical methyltransferase protein 19 Cluster: 2586.7 cher hypothetical similar protein to product methyltransferase gene: number x73681 Conserved regions: Cluster 2586.5 | __ _____ ______| Cluster 2586.7 | _______ ____| Local hits (HSPs): ___ ____ __________________________________________________ Database sequence: | | | | | 492 0 150 300 450 Minus Strand HSPs: Score = 56 (25.8 bits), Expect = 9.5, Sum P(2) = 1.0 Identities = 10/25 (40%), Positives = 16/25 (64%), Frame = -3 Query: 951 GFAIRYITALLTRQILQAFQPDIRL 877 G +RY+ +TR +L QP++RL Sbjct: 329 GRFLRYVAGEITRNLLTLIQPELRL 353 Score = 43 (19.8 bits), Expect = 9.5, Sum P(2) = 1.0 Identities = 10/29 (34%), Positives = 12/29 (41%), Frame = -2 Query: 520 CSDATAAMPTPPSGQWFSLSQSRRRPRYC 434 CS TP S + SRRR + C Sbjct: 436 CSGPNCTCRTPSSNRKSPARSSRRRTKKC 464
bbs|140965|gi|455942 wingless protein=wg/wingless wgIL114 [Drosophila, Peptide Mutant, 468 aa] Length = 468 Local hits (HSPs): ___ ___ __ __________________________________________________ Database sequence: | | | | | 468 0 150 300 450 Plus Strand HSPs: Score = 45 (20.7 bits), Expect = 10., Sum P(3) = 1.0 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +1 Query: 208 AVTDWFDGFLARRWNQSTR 264 A+++ F RRWN STR Sbjct: 89 AISECQHQFRNRRWNSSTR 107 Score = 43 (19.8 bits), Expect = 10., Sum P(3) = 1.0 Identities = 7/11 (63%), Positives = 8/11 (72%), Frame = +3 Query: 585 VAIFERCACRF 617 V + ERCAC F Sbjct: 437 VVVVERCACTF 447 Score = 38 (17.5 bits), Expect = 10., Sum P(3) = 1.0 Identities = 7/15 (46%), Positives = 7/15 (46%), Frame = +2 Query: 482 RWWRWHGCCGVRTFG 526 R W W GC FG Sbjct: 178 RDWEWGGCSDNIGFG 192
pir||S32661|gi|420769 OAC2 protein - Azorhizobium caulinodans Length = 296 Cluster: 2200.8 dtdp-4-dehydrorhamnose putative thymidine protein dtdp-4-keto-l-rhamnose reductase dtdp-6-deoxy-l-mannose dehydrogenase dtdp-l-rhamnose synthetase Conserved regions: Cluster 2200.8 |___ _______________ _____ | Local hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | | | 296 0 50 100 150 200 250 Minus Strand HSPs: Score = 65 (29.9 bits), Expect = 10., P = 1.0 Identities = 12/32 (37%), Positives = 19/32 (59%), Frame = -2 Query: 643 YAETITDQANLHAQRSNIATLTTESVPQPQRK 548 +A+ I D+A + RS +A +TT P P R+ Sbjct: 223 FAQAIIDRAATYTGRSEVAAITTAEYPTPARR 254
bbs|114265|gi|256412 lincomycin-resistance determinant LmrB=23S rRNA adenine(2058)-N-methyltransferase homolog [Streptomyces lincolnensis, 78-11, Peptide, 278 aa] Length = 278 Cluster: 2933.6 midecamycin-resistance myrb resistance erythromycin rrna n-6-methyltransferase protein x62867 streptomyces peptide Conserved regions: Cluster 2933.6 |_ _____ ____ _____ ____ | Local hits (HSPs): ________ _____ __________________________________________________ Database sequence: | | | | | | | 278 0 50 100 150 200 250 Minus Strand HSPs: Score = 56 (25.8 bits), Expect = 11., Sum P(2) = 1.0 Identities = 12/43 (27%), Positives = 19/43 (44%), Frame = -2 Query: 547 VQYRRTQPKCSDATAAMPTPPSGQWFSLSQSRRRPRYCVYPTP 419 VQ+ + + ++ T S WF S +R PR+ P P Sbjct: 125 VQWEVARRRAGIGGCSLVTAESWPWFDFSVLKRVPRFAFRPAP 167 Score = 40 (18.4 bits), Expect = 11., Sum P(2) = 1.0 Identities = 9/26 (34%), Positives = 11/26 (42%), Frame = -2 Query: 253 GSSGVPENHRTSQSPPRRRK*ARRQT 176 G VP R PPR + RR + Sbjct: 252 GGRSVPRTRRPRGLPPRTSRGPRRNS 277
gi|581701 methyltransferase Length = 278 Cluster: 2933.6 midecamycin-resistance myrb resistance erythromycin rrna n-6-methyltransferase protein x62867 streptomyces peptide Conserved regions: Cluster 2933.6 |_ _____ ____ _____ ____ | Local hits (HSPs): ________ _____ __________________________________________________ Database sequence: | | | | | | | 278 0 50 100 150 200 250 Minus Strand HSPs: Score = 56 (25.8 bits), Expect = 11., Sum P(2) = 1.0 Identities = 12/43 (27%), Positives = 19/43 (44%), Frame = -2 Query: 547 VQYRRTQPKCSDATAAMPTPPSGQWFSLSQSRRRPRYCVYPTP 419 VQ+ + + ++ T S WF S +R PR+ P P Sbjct: 125 VQWEVARRRAGIGGCSLVTAESWPWFDFSVLKRVPRFAFRPAP 167 Score = 40 (18.4 bits), Expect = 11., Sum P(2) = 1.0 Identities = 9/26 (34%), Positives = 11/26 (42%), Frame = -2 Query: 253 GSSGVPENHRTSQSPPRRRK*ARRQT 176 G VP R PPR + RR + Sbjct: 252 GGRSVPRTRRPRGLPPRTSRGPRRNS 277
sp|P18175|INVO_PIG|gi|124735 INVOLUCRIN. Length = 347 Cluster: 5789.3 involucrin Conserved regions: Cluster 5789.3 |_____________________ | Local hits (HSPs): ______ __________ Annotated Domains: ____________ _______ __________________________________________________ Database sequence: | | | | 347 0 150 300 __________________ Annotated Domains: BLOCKS BL00795A: Involucrin proteins. 1..35 BLOCKS BL00795B: Involucrin proteins. 41..80 BLOCKS BL00795C: Involucrin proteins. 240..284 PROSITE INVOLUCRIN: Involucrin signature. 1..11 __________________ Minus Strand HSPs: Score = 57 (26.2 bits), Expect = 11., Sum P(2) = 1.0 Identities = 13/37 (35%), Positives = 21/37 (56%), Frame = -3 Query: 279 KESTKPGTLVPAACQKTIEPVSHRRDAENERGGKRRP 169 ++ T P TL PA Q+ ++PVS D + E+ + P Sbjct: 3 QQYTLPVTLPPALSQEPLKPVSPPADTQQEQVKQATP 39 Score = 40 (18.4 bits), Expect = 11., Sum P(2) = 1.0 Identities = 11/47 (23%), Positives = 24/47 (51%), Frame = -3 Query: 162 RQIKDQYKEWDKDDTEQCKQRRDIKLHNDG*LSVVSKITPMLLQRHQ 22 +Q + Q +E D +Q ++ ++ +LH D S++ + + HQ Sbjct: 110 QQQESQEQELHVDQQQQQQESQEQELHVDQQQQQESQVQELHVGHHQ 156 Score = 36 (16.6 bits), Expect = 38., Sum P(2) = 1.0 Identities = 8/29 (27%), Positives = 17/29 (58%), Frame = -3 Query: 162 RQIKDQYKEWDKDDTEQCKQRRDIKLHND 76 +Q + Q +E D +Q ++ ++ +LH D Sbjct: 94 QQQESQVQELHVDQQQQQQESQEQELHVD 122
gi|581699 bases 361..1197 in X62867 Length = 279 Cluster: 2933.6 midecamycin-resistance myrb resistance erythromycin rrna n-6-methyltransferase protein x62867 streptomyces peptide Conserved regions: Cluster 2933.6 |_ _____ ___ _____ ____ | Local hits (HSPs): ________ _____ __________________________________________________ Database sequence: | | | | | | | 279 0 50 100 150 200 250 Minus Strand HSPs: Score = 56 (25.8 bits), Expect = 11., Sum P(2) = 1.0 Identities = 12/43 (27%), Positives = 19/43 (44%), Frame = -2 Query: 547 VQYRRTQPKCSDATAAMPTPPSGQWFSLSQSRRRPRYCVYPTP 419 VQ+ + + ++ T S WF S +R PR+ P P Sbjct: 126 VQWEVARRRAGIGGCSLVTAESWPWFDFSVLKRVPRFAFRPAP 168 Score = 40 (18.4 bits), Expect = 11., Sum P(2) = 1.0 Identities = 9/26 (34%), Positives = 11/26 (42%), Frame = -2 Query: 253 GSSGVPENHRTSQSPPRRRK*ARRQT 176 G VP R PPR + RR + Sbjct: 253 GGRSVPRTRRPRGLPPRTSRGPRRNS 278
pir||S33978|gi|479473 hypothetical protein - African clawed frog transposon 1a11 Length = 653 Local hits (HSPs): ______ ___ Annotated Domains: __ __________________________________________________ Database sequence: | | | | | | 653 0 150 300 450 600 __________________ Annotated Domains: PROSITE ATP_GTP_A: ATP/GTP-binding site motif A 284..291 __________________ Minus Strand HSPs: Score = 44 (20.2 bits), Expect = 11., Sum P(3) = 1.0 Identities = 7/13 (53%), Positives = 9/13 (69%), Frame = -3 Query: 318 HGDSHENFICHRV 280 HGD+ F CH+V Sbjct: 206 HGDTRRCFSCHQV 218 Score = 43 (19.8 bits), Expect = 11., Sum P(3) = 1.0 Identities = 10/27 (37%), Positives = 15/27 (55%), Frame = -3 Query: 192 ERGGKRRPGDRQIKDQYKEWDKDDTEQ 112 ERG + RP D K Q E +++ E+ Sbjct: 572 ERGTRDRPEDPTGKGQIAETEENQEEE 598 Score = 41 (18.9 bits), Expect = 11., Sum P(3) = 1.0 Identities = 13/48 (27%), Positives = 19/48 (39%), Frame = -2 Query: 598 SNIATLTTESVPQPQRKVQYRRTQPKCSDATAAMPTPPSGQWFSLSQS 455 + IA S RK + +P+ +D MP S Q S+S Sbjct: 147 AEIADTYAASRVPDSRKSSFHSWKPRKADVNLTMPPSLSAQHARSSES 194
sp|P15586|GL6S_HUMAN|gi|232126 N-ACETYLGLUCOSAMINE-6-SULFATASE PRECURSOR (G6S) (GLUCOSAMINE-6-SULFATASE). Length = 552 Cluster: 4462.4 mature n-acetylglucosamine-6-sulfatase arylsulfatase precursor kd protein in ilvo-ibpb intergenic region Conserved regions: Cluster 4462.4 |____ _____________| Local hits (HSPs): __ ___ __ Annotated Domains: _ _________________________________________ __________________________________________________ Database sequence: | | | | | 552 0 150 300 450 __________________ Annotated Domains: Entrez modified site: 2-AMINO-3-OXOPROPIONIC AC 91 Entrez glycosylation site 111 Entrez glycosylation site 117 Entrez glycosylation site 183 Entrez glycosylation site 198 Entrez glycosylation site 210 Entrez glycosylation site 279 Entrez glycosylation site 317 Entrez glycosylation site 362 Entrez glycosylation site 387 Entrez glycosylation site 405 Entrez glycosylation site 422 Entrez glycosylation site 449 Entrez glycosylation site 480 PFAM Sulfatase: Sulfatase 47..485 BLOCKS BL00523A: Sulfatases proteins. 47..63 BLOCKS BL00523B: Sulfatases proteins. 91..102 BLOCKS BL00523C: Sulfatases proteins. 141..151 BLOCKS BL00523D: Sulfatases proteins. 224..235 BLOCKS BL00523E: Sulfatases proteins. 299..328 BLOCKS BL00523F: Sulfatases proteins. 373..383 BLOCKS BL00523G: Sulfatases proteins. 478..487 PROSITE PROKAR_LIPOPROTEIN: Prokaryotic membrane 24..34 PROSITE SULFATASE_1: Sulfatases signature 1. 89..101 PROSITE SULFATASE_2: Sulfatases signature 2. 141..151 __________________ Plus Strand HSPs: Score = 49 (22.5 bits), Expect = 14., Sum P(3) = 1.0 Identities = 12/18 (66%), Positives = 13/18 (72%), Frame = +2 Query: 230 VFWHAAGTRVPGLVLSLT 283 VF AAGTR P +VL LT Sbjct: 37 VFGVAAGTRRPNVVLLLT 54 Score = 41 (18.9 bits), Expect = 14., Sum P(3) = 1.0 Identities = 7/13 (53%), Positives = 9/13 (69%), Frame = +1 Query: 502 LLWRPNIWVEYAG 540 L WR ++ VEY G Sbjct: 406 LTWRSDVLVEYQG 418 Score = 36 (16.6 bits), Expect = 14., Sum P(3) = 1.0 Identities = 8/24 (33%), Positives = 13/24 (54%), Frame = +2 Query: 383 VKLLFLRYANGWRSWVNAVAWPSP 454 V L FL Y + + + +A P+P Sbjct: 211 VSLDFLDYKSNFEPFFMMIATPAP 234
gi|457707 CshA protein Length = 2508 Local hits (HSPs): _ __________________________________________________ Database sequence: | | | | | || 2508 0 500 1000 1500 2000 2500 Minus Strand HSPs: Score = 64 (29.4 bits), Expect = 17., P = 1.0 Identities = 12/34 (35%), Positives = 19/34 (55%), Frame = -2 Query: 304 RELYLPQGQGKHQTGYSGSSGVPENHRTSQSPPR 203 R +Y PQG+ + TG+ G + H T++ P R Sbjct: 668 RRVYPPQGEKQESTGFQGETQNASVHFTAKGPDR 701
gi|577742 C09G5.6, similar to Collagen Length = 963 Local hits (HSPs): __ __ __ __ __________________________________________________ Database sequence: | | | | | | | | 963 0 150 300 450 600 750 900 Minus Strand HSPs: Score = 44 (20.2 bits), Expect = 17., Sum P(4) = 1.0 Identities = 10/26 (38%), Positives = 14/26 (53%), Frame = -1 Query: 845 RDSNSRPRPWQGRALPTELFPHSSSN 768 R+ S RP+ + P+ PHSS N Sbjct: 180 REPASSRRPYPPQQPPSTSAPHSSPN 205 Score = 38 (17.5 bits), Expect = 17., Sum P(4) = 1.0 Identities = 8/20 (40%), Positives = 10/20 (50%), Frame = -2 Query: 268 QTGYSGSSGVPENHRTSQSP 209 Q G G+ G P H + SP Sbjct: 469 QDGQPGAPGAPGYHGMNGSP 488 Score = 37 (17.0 bits), Expect = 17., Sum P(4) = 1.0 Identities = 10/30 (33%), Positives = 11/30 (36%), Frame = -2 Query: 577 TESVPQPQRKVQYRRTQPKCSDATAAMPTP 488 T + P P Q R P SD TP Sbjct: 316 TRNPPNPTNTRQPSRPVPPTSDGHIEATTP 345 Score = 36 (16.6 bits), Expect = 17., Sum P(4) = 1.0 Identities = 10/29 (34%), Positives = 16/29 (55%), Frame = -3 Query: 168 GDRQIKDQYKEWDKDDTEQCKQRRDIKLH 82 GD++ K+Q + D E+ K+R K H Sbjct: 838 GDKRKKNQPEYEDISKPEEDKERAMEKHH 866
sp|P20715|HMDH_XENLA|gi|123347 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE (HMG-COA REDUCTASE). Length = 883 Cluster: 339.32 3-hydroxy-3-methylglutaryl 3-hydroxy-3-methylglutaryl-coenzyme human hydroxymethylglutaryl-coa coenzyme 1 2 a reductase hmg-coa Cluster: 339.34 3-hydroxy-3-methylglutaryl-coenzyme human hydroxymethylglutaryl-coa 1 2 a nadph reductase ec hmg-coa Cluster: 339.35 3-hydroxy-3-methylglutaryl-coenzyme hydroxymethylglutaryl-coa nadph a reductase 2 hmg-coa hmgr 1.1.1.34 ec Conserved regions: Cluster 339.32 | _____ ____ _______| Cluster 339.34 |__ __________ _| Cluster 339.35 |_ __| Local hits (HSPs): __ __ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | | | | 883 0 150 300 450 600 750 __________________ Annotated Domains: Entrez Domain: MEMBRANE-BOUND. 1..341 Entrez Domain: LINKER. 342..444 Entrez Domain: CATALYTIC. 445..883 Entrez Transmembrane region 10..39 Entrez Transmembrane region 57..78 Entrez Transmembrane region 90..114 Entrez Transmembrane region 124..149 Entrez Transmembrane region 160..187 Entrez Transmembrane region 192..220 Entrez Transmembrane region 315..339 Entrez active site 554 Entrez active site 762 Entrez active site: GENERAL BASE. 861 PFAM HMG-CoA_red1: Hydroxymethylglutaryl-coen 634..666 PFAM HMG-CoA_red2: Hydroxymethylglutaryl-coen 776..804 PRINTS HMGCOARDTASE1: HMG-CoA reductase motif I 521..542 PRINTS HMGCOARDTASE2: HMG-CoA reductase motif I 548..568 PRINTS HMGCOARDTASE3: HMG-CoA reductase motif I 639..657 PRINTS HMGCOARDTASE4: HMG-CoA reductase motif I 679..704 PRINTS HMGCOARDTASE5: HMG-CoA reductase motif V 730..756 PRINTS HMGCOARDTASE6: HMG-CoA reductase motif V 785..806 BLOCKS BL00066A: Hydroxymethylglutaryl-coenzyme 88..97 BLOCKS BL00066B: Hydroxymethylglutaryl-coenzyme 534..586 BLOCKS BL00066C: Hydroxymethylglutaryl-coenzyme 623..660 BLOCKS BL00066D: Hydroxymethylglutaryl-coenzyme 670..718 BLOCKS BL00066E: Hydroxymethylglutaryl-coenzyme 730..777 BLOCKS BL00066F: Hydroxymethylglutaryl-coenzyme 826..867 PROSITE HMG_COA_REDUCTASE_1: Hydroxymethylglutar 641..655 PROSITE HMG_COA_REDUCTASE_2: Hydroxymethylglutar 797..804 PROSITE HMG_COA_REDUCTASE_3: Hydroxymethylglutar 851..864 PROSITE PROKAR_LIPOPROTEIN: Prokaryotic membrane 511..521 __________________ Plus Strand HSPs: Score = 58 (26.7 bits), Expect = 18., Sum P(2) = 1.0 Identities = 10/30 (33%), Positives = 20/30 (66%), Frame = +1 Query: 280 DPVADKVLVAIAMVLVTEHYHSWWVTLPAA 369 +PV +V + +++ LV H HS W++ P++ Sbjct: 251 NPVTQRVKMIMSLGLVLVHAHSRWISEPSS 280 Score = 41 (18.9 bits), Expect = 18., Sum P(2) = 1.0 Identities = 7/20 (35%), Positives = 15/20 (75%), Frame = +2 Query: 662 KVVKNIVDSSRQVSRMQRIE 721 KV+K+ DS+ + +R+ R++ Sbjct: 611 KVIKDAFDSTSRFARLGRLQ 630
sp|P22726|WN5B_MOUSE|gi|139724 WNT-5B PROTEIN PRECURSOR. Length = 372 Cluster: 76.79 wnt-5b xwnt-5c wnt-5a protein xwnt-5a precursor xenopus zebrafish peptide aa Cluster: 76.92 wnt-3a wnt-5b wnt-5a gene protein product precursor peptide partial aa Conserved regions: Cluster 76.79 |__ __ __| Cluster 76.92 | _| Local hits (HSPs): __ ___ __ Annotated Domains: ___________________________________________ __________________________________________________ Database sequence: | | | | 372 0 150 300 __________________ Annotated Domains: Entrez glycosylation site 106 Entrez glycosylation site 112 Entrez glycosylation site 304 Entrez glycosylation site 318 PFAM wnt: wnt family of developmental signali 60..372 BLOCKS BL00246A: Wnt-1 family proteins. 88..107 BLOCKS BL00246B: Wnt-1 family proteins. 123..157 BLOCKS BL00246C: Wnt-1 family proteins. 169..193 BLOCKS BL00246D: Wnt-1 family proteins. 210..262 BLOCKS BL00246E: Wnt-1 family proteins. 326..371 PROSITE WNT1: Wnt-1 family signature. 230..239 __________________ Plus Strand HSPs: Score = 49 (22.5 bits), Expect = 19., Sum P(3) = 1.0 Identities = 8/12 (66%), Positives = 8/12 (66%), Frame = +2 Query: 470 KPLPRWWRWHGC 505 K LPR W W GC Sbjct: 163 KDLPRDWLWGGC 174 Score = 37 (17.0 bits), Expect = 19., Sum P(3) = 1.0 Identities = 6/7 (85%), Positives = 6/7 (85%), Frame = +3 Query: 597 ERCACRF 617 ERC CRF Sbjct: 345 ERCHCRF 351 Score = 36 (16.6 bits), Expect = 19., Sum P(3) = 1.0 Identities = 7/10 (70%), Positives = 7/10 (70%), Frame = +1 Query: 232 FLARRWNQST 261 F RRWN ST Sbjct: 100 FRQRRWNCST 109
sp|P15822|ZEP1_HUMAN|gi|141697 ZINC FINGER PROTEIN 40 (HUMAN IMMUNODEFICIENCY VIRUS TYPE I ENHANCER-BINDING PROTEIN 1) (HIV-EP1) (MAJOR HISTOCOMPATIBILITY COMPLEX BINDING PROTEIN 1) (MBP-1) (POSITIVE REGULATORY DOMAIN II BINDING FACTOR 1) (PRDII-BF1). Length = 2717 Cluster: 1302.9 zinc finger virus major protein type histocompatibility enhancer-binding binding 1 Cluster: 1302.12 dna-binding zinc finger major protein histocompatibility enhancer-binding binding 1 2 Conserved regions: Cluster 1302.9 |___ | Cluster 1302.12 |_| Local hits (HSPs): __ _ Annotated Domains: __ _ __ __ __________________________________________________ Database sequence: | | | | | | | 2717 0 500 1000 1500 2000 2500 __________________ Annotated Domains: Entrez Domain: ZINC-FINGERS. 406..456 Entrez Zinc finger region: C2H2-TYPE. 406..428 Entrez Zinc finger region: C2H2-TYPE. 434..456 Entrez Domain: POLY-SER. 803..806 Entrez Zinc finger region: C2HC-TYPE. 958..981 Entrez Domain: ZINC-FINGERS. 2087..2139 Entrez Zinc finger region: C2H2-TYPE. 2087..2109 Entrez Zinc finger region: C2H2-TYPE. 2115..2139 PFAM zf-C2H2: Zinc finger, C2H2 type 406..428 PFAM zf-C2H2: Zinc finger, C2H2 type 434..456 PFAM zf-C2H2: Zinc finger, C2H2 type 958..981 PFAM zf-C2H2: Zinc finger, C2H2 type 2087..2109 PFAM zf-C2H2: Zinc finger, C2H2 type 2115..2139 PRINTS ZINCFINGER1: First half of finger motif 433..446 PRINTS ZINCFINGER2: Second half of finger motif 2102..2111 BLOCKS BL00028: Zinc finger, C2H2 type, domain 436..452 __________________ Minus Strand HSPs: Score = 57 (26.2 bits), Expect = 21., Sum P(2) = 1.0 Identities = 12/35 (34%), Positives = 18/35 (51%), Frame = -3 Query: 294 ICHRVKESTKPGTLVPAACQKTIEPVSHRRDAENE 190 +CHR K PG + P KT+E + ++NE Sbjct: 721 LCHREKALLLPGQMRPPLATKTLEERISKLISDNE 755 Score = 45 (20.7 bits), Expect = 21., Sum P(2) = 1.0 Identities = 8/26 (30%), Positives = 13/26 (50%), Frame = -3 Query: 552 EKCNTGVLNPNVRTPQQPCQRHHLGS 475 E+C++ L+ RT C H G+ Sbjct: 161 EQCDSSSLSSKTRTDNSECISSHCGT 186
sp|Q05556|CPAB_RABIT|gi|544086 CYTOCHROME P450 IIA11 (P450-IIA11). Length = 494 Cluster: 167.56 cytochrome testosterone ec p-450 coumarin p450 1.14.14.- naphthalene hydroxylase phenobarbital-inducible Cluster: 167.57 cytochrome p-450 testosterone ec coumarin p450 1.14.14.- naphthalene phenobarbital-inducible s-mephenytoin Cluster: 167.59 cytochrome p-450 testosterone ec coumarin p450 1.14.14.- naphthalene phenobarbital-inducible s-mephenytoin Conserved regions: Cluster 167.56 |_ ___ ________ ____ ____ _____| Cluster 167.57 |______________ | Cluster 167.59 | __ ___| Local hits (HSPs): ______ Annotated Domains: __ _______________________________________________ __________________________________________________ Database sequence: | | | | | 494 0 150 300 450 __________________ Annotated Domains: Entrez binding site: HEME. 439 PFAM p450: Cytochrome P450 34..491 PRINTS EP450I1: E-class P450 group I motif I - 62..81 PRINTS EP450I2: E-class P450 group I motif II - 86..107 PRINTS EP450I3: E-class P450 group I motif III 177..195 PRINTS EP450I4: E-class P450 group I motif IV - 290..307 PRINTS P4501: P450 superfamily motif I - 4 301..318 PRINTS EP450I5: E-class P450 group I motif V - 310..336 PRINTS P4502: P450 superfamily motif II - 4 319..332 PRINTS EP450I6: E-class P450 group I motif VI - 353..371 PRINTS P4503: P450 superfamily motif III - 4 354..365 PRINTS EP450I7: E-class P450 group I motif VII 394..418 PRINTS EP450I8: E-class P450 group I motif VIII 429..439 PRINTS P4504: P450 superfamily motif IV - 4 430..439 PRINTS EP450I9: E-class P450 group I motif IX - 439..462 PRINTS P4505: P450 superfamily motif V - 4 439..450 BLOCKS BL00086: Cytochrome P450 cysteine heme-i 429..460 PROSITE CYTOCHROME_P450: Cytochrome P450 cystein 432..441 PROSITE PROKAR_LIPOPROTEIN: Prokaryotic membrane 4..14 __________________ Plus Strand HSPs: Score = 63 (29.0 bits), Expect = 21., P = 1.0 Identities = 18/57 (31%), Positives = 26/57 (45%), Frame = +1 Query: 175 PFAAALIFCVAAVTDWFDGFLARRWNQSTRFGAFLDPVADKVLVAIAMVLVTEHYHS 345 P+ A+I + TD LARR + T+F FL P +V + VL + S Sbjct: 350 PYTEAVIHEIQRFTDMIPMGLARRVTRDTKFRDFLLPKGTEVFPMLGSVLKDPKFFS 406
sp|P16766|UL35_HCMVA|gi|136891 HYPOTHETICAL PROTEIN UL35. Length = 640 Local hits (HSPs): _______ Annotated Domains: _ _ _ __________________________________________________ Database sequence: | | | | | | 640 0 150 300 450 600 __________________ Annotated Domains: Entrez glycosylation site 208 PROSITE TYR_PHOSPHO_SITE: Tyrosine kinase phosph 106..113 PROSITE TYR_PHOSPHO_SITE: Tyrosine kinase phosph 271..277 __________________ Minus Strand HSPs: Score = 63 (29.0 bits), Expect = 22., P = 1.0 Identities = 20/75 (26%), Positives = 34/75 (45%), Frame = -2 Query: 679 DIFHHF*SFAENYAETITDQANLHAQRSNIATLTTESVPQPQRKVQYRRTQPKCSDATAA 500 +I H FA+ + +TD A+ + S+ ++ + SV P + RT S T+A Sbjct: 480 EITEHRDLFADVFRRPVTDAASSSSASSSSSSASPNSVSLPSARSSSTRTTTPASTYTSA 539 Query: 499 MPTPPSGQWFSLSQS 455 + +G S S S Sbjct: 540 GTSSTTGLLLSSSLS 554
sp|P09615|WNTG_DROME|gi|139777 PROTEIN DINT-1 PRECURSOR (WINGLESS PROTEIN). Length = 468 Cluster: 546.24 wnt-11 wnt-4 wnt-1 dint-1 proto-oncogene protein wingless precursor peptide aa Conserved regions: Cluster 546.24 |__ _______ _____ __| Local hits (HSPs): ___ ___ __ Annotated Domains: _________________________ ___________ __________________________________________________ Database sequence: | | | | | 468 0 150 300 450 __________________ Annotated Domains: Entrez glycosylation site 103 Entrez glycosylation site 108 Entrez glycosylation site 414 PFAM wnt: wnt family of developmental signali 56..275 PFAM wnt: wnt family of developmental signali 370..468 BLOCKS BL00246A: Wnt-1 family proteins. 85..104 BLOCKS BL00246B: Wnt-1 family proteins. 123..157 BLOCKS BL00246C: Wnt-1 family proteins. 180..204 BLOCKS BL00246D: Wnt-1 family proteins. 213..265 BLOCKS BL00246E: Wnt-1 family proteins. 422..467 PROSITE WNT1: Wnt-1 family signature. 233..242 __________________ Plus Strand HSPs: Score = 43 (19.8 bits), Expect = 24., Sum P(3) = 1.0 Identities = 7/11 (63%), Positives = 8/11 (72%), Frame = +3 Query: 585 VAIFERCACRF 617 V + ERCAC F Sbjct: 437 VVVVERCACTF 447 Score = 42 (19.3 bits), Expect = 24., Sum P(3) = 1.0 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +1 Query: 208 AVTDWFDGFLARRWNQSTR 264 A+++ F RRWN STR Sbjct: 89 AISECQHQFRNRRWNCSTR 107 Score = 38 (17.5 bits), Expect = 24., Sum P(3) = 1.0 Identities = 7/15 (46%), Positives = 7/15 (46%), Frame = +2 Query: 482 RWWRWHGCCGVRTFG 526 R W W GC FG Sbjct: 178 RDWEWGGCSDNIGFG 192
bbs|140967|gi|455944 wingless protein=wg/wingless wgIN67 [Drosophila, Peptide Mutant, 468 aa] Length = 468 Local hits (HSPs): ___ ___ __ __________________________________________________ Database sequence: | | | | | 468 0 150 300 450 Plus Strand HSPs: Score = 43 (19.8 bits), Expect = 24., Sum P(3) = 1.0 Identities = 7/11 (63%), Positives = 8/11 (72%), Frame = +3 Query: 585 VAIFERCACRF 617 V + ERCAC F Sbjct: 437 VVVVERCACTF 447 Score = 42 (19.3 bits), Expect = 24., Sum P(3) = 1.0 Identities = 9/19 (47%), Positives = 12/19 (63%), Frame = +1 Query: 208 AVTDWFDGFLARRWNQSTR 264 A+++ F RRWN STR Sbjct: 89 AISECQHQFRNRRWNCSTR 107 Score = 38 (17.5 bits), Expect = 24., Sum P(3) = 1.0 Identities = 7/15 (46%), Positives = 7/15 (46%), Frame = +2 Query: 482 RWWRWHGCCGVRTFG 526 R W W GC FG Sbjct: 178 RDWEWGGCSDNIGFG 192
sp|P35503|UD1C_HUMAN|gi|549152 UDP-GLUCURONOSYLTRANSFERASE 1C PRECURSOR, MICROSOMAL (UDPGT) (UGT1C) (UGT1*3). Length = 534 Cluster: 1040.13 udp-glucuronosyltransferase precursor bilirubin microsomal peptide 1a udpgt aa specific isozyme Cluster: 1040.14 udp-glucuronosyltransferase precursor 1f bilirubin microsomal peptide udpgt aa specific isozyme Conserved regions: Cluster 1040.13 | ________________________| Cluster 1040.14 |_ __ __________________| Local hits (HSPs): ___ __ Annotated Domains: ________________________________________________ __________________________________________________ Database sequence: | | | | | 534 0 150 300 450 __________________ Annotated Domains: Entrez Transmembrane region 492..508 Entrez glycosylation site 119 Entrez glycosylation site 142 Entrez glycosylation site 296 Entrez glycosylation site 348 PFAM UDPGT: UDP-glucoronosyl and UDP-glucosyl 29..526 BLOCKS BL00375A: UDP-glycosyltransferases prote 39..61 BLOCKS BL00375B: UDP-glycosyltransferases prote 128..168 BLOCKS BL00375C: UDP-glycosyltransferases prote 190..213 BLOCKS BL00375D: UDP-glycosyltransferases prote 254..281 BLOCKS BL00375E: UDP-glycosyltransferases prote 294..343 BLOCKS BL00375F: UDP-glycosyltransferases prote 349..393 BLOCKS BL00375G: UDP-glycosyltransferases prote 448..487 PROSITE UDPGT: UDP-glycosyltransferases signatur 355..398 __________________ Minus Strand HSPs: Score = 52 (23.9 bits), Expect = 26., Sum P(2) = 1.0 Identities = 10/29 (34%), Positives = 16/29 (55%), Frame = -2 Query: 640 AETITDQANLHAQRSNIATLTTESVPQPQ 554 A +T + N+H + N TLTT ++ Q Sbjct: 58 AVVLTPEVNMHIKEENFFTLTTYAISWTQ 86 Score = 44 (20.2 bits), Expect = 26., Sum P(2) = 1.0 Identities = 10/22 (45%), Positives = 13/22 (59%), Frame = -1 Query: 500 HANATIWAVVFTFPIQETATLL 435 H NAT + VV T P+ A +L Sbjct: 140 HLNATSFDVVLTDPVNLCAAVL 161
sp|P00744|PRTZ_BOVIN|gi|131090 VITAMIN K-DEPENDENT PROTEIN Z. Length = 396 Cluster: 3591.3 factor plasma vitamin k-dependent l x1 protein z precursor Conserved regions: Cluster 3591.3 | ____ __ | Local hits (HSPs): _______ _____ Annotated Domains: ________________ _________________________________ __________________________________________________ Database sequence: | | | | 396 0 150 300 __________________ Annotated Domains: Entrez Domain: EGF-LIKE 1. 47..83 Entrez Domain: EGF-LIKE 2. 85..126 Entrez Domain: TRYPSIN-LIKE. 143..396 Entrez gamma-carboxyglutamic-acid site 7 Entrez gamma-carboxyglutamic-acid site 8 Entrez gamma-carboxyglutamic-acid site 11 Entrez gamma-carboxyglutamic-acid site 15 Entrez gamma-carboxyglutamic-acid site 17 Entrez gamma-carboxyglutamic-acid site 20 Entrez gamma-carboxyglutamic-acid site 21 Entrez gamma-carboxyglutamic-acid site 26 Entrez gamma-carboxyglutamic-acid site 27 Entrez gamma-carboxyglutamic-acid site 30 Entrez gamma-carboxyglutamic-acid site 33 Entrez gamma-carboxyglutamic-acid site 36 Entrez gamma-carboxyglutamic-acid site 40 Entrez hydroxylation site 64 Entrez glycosylation site: XYLOSE(2)-GLUCOSE. 53 Entrez glycosylation site 59 Entrez glycosylation site 191 Entrez glycosylation site 289 Entrez glycosylation site 388 PFAM gla: Vitamin K-dependent carboxylation/g 6..47 PFAM EGF: EGF-like domain 51..82 PFAM EGF: EGF-like domain 89..125 PFAM trypsin: Trypsin 146..352 PRINTS GLABLOOD1: Coagulation factor Gla domain 5..18 PRINTS GLABLOOD2: Coagulation factor Gla domain 19..32 PRINTS GLABLOOD3: Coagulation factor Gla domain 33..47 PRINTS EGFBLOOD1: Type II EGF-like repeat motif 47..58 PRINTS EGFBLOOD2: Type II EGF-like repeat motif 59..66 PRINTS EGFBLOOD3: Type II EGF-like repeat motif 67..77 PRINTS EGFBLOOD4: Type II EGF-like repeat motif 78..84 BLOCKS BL00022A: EGF-like domain proteins. 56..62 BLOCKS BL00022B: EGF-like domain proteins. 71..77 PROSITE ASX_HYDROXYL: Aspartic acid and asparagi 62..73 PROSITE GLU_CARBOXYLATION: Vitamin K-dependent c 5..42 PROSITE EGF_1: EGF-like domain signature 1. 71..82 PROSITE EGF_2: EGF-like domain signature 2. 71..82 __________________ Minus Strand HSPs: Score = 45 (20.7 bits), Expect = 30., Sum P(3) = 1.0 Identities = 12/42 (28%), Positives = 14/42 (33%), Frame = -3 Query: 576 QSQYRSHKEKCNTGVLNPNVRTPQQPCQRHHLGSGFHFPNPG 451 Q R + C G PN + C L HF PG Sbjct: 63 QDSIRGYACTCAPGYEGPNCAFAESECHPLRLDGCQHFCYPG 104 Score = 40 (18.4 bits), Expect = 30., Sum P(3) = 1.0 Identities = 7/20 (35%), Positives = 11/20 (55%), Frame = -1 Query: 275 KAPNRVLWFQRRARKPSNQS 216 K P LW ++ ++PS S Sbjct: 344 KVPRYALWLRQVTQQPSRAS 363 Score = 36 (16.6 bits), Expect = 30., Sum P(3) = 1.0 Identities = 9/19 (47%), Positives = 10/19 (52%), Frame = -3 Query: 216 SHRRDAENERGGKRRPGDR 160 S R D R G+ PGDR Sbjct: 363 SPRGDRGQGRDGEPVPGDR 381
sp|P09346|KNOB_PLAFG|gi|125516 KNOB-ASSOCIATED HISTIDINE-RICH PROTEIN PRECURSOR (KAHRP). Length = 634 Local hits (HSPs): __ ____ Annotated Domains: _______ ____ __ ______ ____ __________________________________________________ Database sequence: | | | | | | 634 0 150 300 450 600 __________________ Annotated Domains: Entrez Domain: HIS-RICH. 61..116 Entrez Domain: 13 AA TANDEM REPEATS. 370..438 Entrez Domain: 4 X 10 AA APPROXIMATE TANDEM REP 540..580 Entrez glycosylation site 42 PROSITE TYR_PHOSPHO_SITE: Tyrosine kinase phosph 152..158 PROSITE TYR_PHOSPHO_SITE: Tyrosine kinase phosph 173..180 PROSITE TYR_PHOSPHO_SITE: Tyrosine kinase phosph 174..180 PROSITE TYR_PHOSPHO_SITE: Tyrosine kinase phosph 292..299 __________________ Minus Strand HSPs: Score = 59 (27.1 bits), Expect = 31., Sum P(2) = 1.0 Identities = 12/39 (30%), Positives = 20/39 (51%), Frame = -3 Query: 204 DAENERGGKRRPGDRQIKDQYKEWDKDDTEQCKQRRDIK 88 DAE+ + K + D + K K D +D E K ++ +K Sbjct: 400 DAESVKSKKHKSHDCEKKKSKKHKDNEDAESVKSKKSVK 438 Score = 37 (17.0 bits), Expect = 31., Sum P(2) = 1.0 Identities = 7/12 (58%), Positives = 7/12 (58%), Frame = -2 Query: 271 HQTGYSGSSGVP 236 H GYS GVP Sbjct: 323 HGAGYSAPYGVP 334
sp|P13818|KNOB_PLAFX|gi|125518 KNOB-ASSOCIATED HISTIDINE-RICH PROTEIN PRECURSOR (KAHRP) (KP). Length = 634 Local hits (HSPs): __ ____ Annotated Domains: _______ ____ __ ______ ____ __________________________________________________ Database sequence: | | | | | | 634 0 150 300 450 600 __________________ Annotated Domains: Entrez Domain: HIS-RICH. 61..116 Entrez Domain: 13 AA TANDEM REPEATS. 370..438 Entrez Domain: 4 X 10 AA APPROXIMATE TANDEM REP 540..580 Entrez glycosylation site 42 PROSITE TYR_PHOSPHO_SITE: Tyrosine kinase phosph 152..158 PROSITE TYR_PHOSPHO_SITE: Tyrosine kinase phosph 173..180 PROSITE TYR_PHOSPHO_SITE: Tyrosine kinase phosph 174..180 PROSITE TYR_PHOSPHO_SITE: Tyrosine kinase phosph 292..299 __________________ Minus Strand HSPs: Score = 59 (27.1 bits), Expect = 31., Sum P(2) = 1.0 Identities = 12/39 (30%), Positives = 20/39 (51%), Frame = -3 Query: 204 DAENERGGKRRPGDRQIKDQYKEWDKDDTEQCKQRRDIK 88 DAE+ + K + D + K K D +D E K ++ +K Sbjct: 400 DAESVKSKKHKSHDCEKKKSKKHKDNEDAESVKSKKSVK 438 Score = 37 (17.0 bits), Expect = 31., Sum P(2) = 1.0 Identities = 7/12 (58%), Positives = 7/12 (58%), Frame = -2 Query: 271 HQTGYSGSSGVP 236 H GYS GVP Sbjct: 323 HGAGYSAPYGVP 334
gi|488833 zinc finger protein 51 Length = 710 Cluster: 28.54 gastrula oocyte zinc finger protein 51 xlcgf58.1 xlcof22 Cluster: 28.107 gastrula oocyte znf37a zinc finger protein zfp-37 znf133 znf140 xlcof8.4 Cluster: 28.141 gastrula oocyte zinc-finger transcriptional zinc finger putative protein mkr5 placental Conserved regions: Cluster 28.54 | _ __ _ __ _____ ____| Cluster 28.107 |_______ | Cluster 28.141 | ___| Local hits (HSPs): ____ __ ___ __________________________________________________ Database sequence: | | | | | | 710 0 150 300 450 600 Minus Strand HSPs: Score = 50 (23.0 bits), Expect = 32., Sum P(3) = 1.0 Identities = 9/30 (30%), Positives = 17/30 (56%), Frame = -3 Query: 546 CNTGVLNPNVRTPQQPCQRHHLGSGFHFPN 457 C ++ +V+T ++ CQ + LG H P+ Sbjct: 15 CICDTVHQHVKTEKESCQGNKLGEMLHEPS 44 Score = 39 (17.9 bits), Expect = 32., Sum P(3) = 1.0 Identities = 8/22 (36%), Positives = 11/22 (50%), Frame = -3 Query: 240 CQKTIEPVSHRRDAENERGGKR 175 C K+ VSH R + G+R Sbjct: 541 CDKSFTQVSHLRTHQRVHTGER 562 Score = 36 (16.6 bits), Expect = 32., Sum P(3) = 1.0 Identities = 6/19 (31%), Positives = 12/19 (63%), Frame = -3 Query: 138 EWDKDDTEQCKQRRDIKLH 82 E+DK +T+ +R ++H Sbjct: 680 EYDKPNTQDSNLKRHQRVH 698
prf||1705218D|gi|227508 Wnt-6 gene Length = 365 Cluster: 76.93 wingless wnt-1 wnt-2 wnt-6 wnt-b xwnt-6 gene protein rerio precursor Conserved regions: Cluster 76.93 |___ _______ | Local hits (HSPs): ___ ___ ___ __________________________________________________ Database sequence: | | | | 365 0 150 300 Plus Strand HSPs: Score = 47 (21.6 bits), Expect = 33., Sum P(3) = 1.0 Identities = 9/21 (42%), Positives = 12/21 (57%), Frame = +3 Query: 555 CGCGTDSVVNVAIFERCACRF 617 CG G + +V + E C CRF Sbjct: 324 CGRGHRAQESVQLEENCLCRF 344 Score = 37 (17.0 bits), Expect = 33., Sum P(3) = 1.0 Identities = 8/15 (53%), Positives = 9/15 (60%), Frame = +1 Query: 232 FLARRWNQSTRFGAF 276 F RRWN S+ AF Sbjct: 79 FRFRRWNCSSHSKAF 93 Score = 36 (16.6 bits), Expect = 33., Sum P(3) = 1.0 Identities = 6/13 (46%), Positives = 6/13 (46%), Frame = +2 Query: 488 WRWHGCCGVRTFG 526 W W GC FG Sbjct: 166 WEWGGCGDDVDFG 178
gi|347377 MLL-AF4 der(11) fusion protein Length = 2311 Local hits (HSPs): _ _ __ __________________________________________________ Database sequence: | | | | | | 2311 0 500 1000 1500 2000 Minus Strand HSPs: Score = 46 (21.2 bits), Expect = 35., Sum P(3) = 1.0 Identities = 8/17 (47%), Positives = 11/17 (64%), Frame = -2 Query: 487 PSGQWFSLSQSRRRPRY 437 P+ +W SL SR P+Y Sbjct: 656 PTFRWTSLKHSRSEPQY 672 Score = 43 (19.8 bits), Expect = 35., Sum P(3) = 1.0 Identities = 11/27 (40%), Positives = 14/27 (51%), Frame = -1 Query: 245 RRARKPSNQSVTAATQKMSAAANGDQV 165 R R P QS TQ++ AAA +V Sbjct: 1628 RHQRAPGAQSPHGGTQRVRAAATVPRV 1654 Score = 43 (19.8 bits), Expect = 35., Sum P(3) = 1.0 Identities = 10/36 (27%), Positives = 18/36 (50%), Frame = -3 Query: 183 GKRRPGDRQIKDQYKEWDKDDTEQCKQRRDIKLHND 76 G +PG Q+K ++ D E+ K ++ +L D Sbjct: 2048 GNSKPGKPQVKFDKQQADLHMREEKKMKQKAELMTD 2083
gi|443822 H,K-ATPase Length = 1042 Cluster: 217.43 sodium/potassium-transporting sodium alpha-1 alpha atpase chain subunit proton pump na+/k+ Cluster: 217.44 sodium/potassium-transporting sodium alpha-1 alpha atpase chain subunit proton pump na+/k+ Cluster: 217.45 sodium/potassium-transporting sodium alpha-1 alpha atpase chain subunit k+ pump na+/k+ Conserved regions: Cluster 217.43 | ____ ____ _ ___ ______ _| Cluster 217.44 |_ ____ ____ _ | Cluster 217.45 | ____ | Local hits (HSPs): _ __ ___ __________________________________________________ Database sequence: | | | | | | | | 1042 0 150 300 450 600 750 900 Plus Strand HSPs: Score = 44 (20.2 bits), Expect = 37., Sum P(3) = 1.0 Identities = 12/42 (28%), Positives = 19/42 (45%), Frame = +1 Query: 523 WVEYAGIALFFVAAVLTLWSMLQYLSAARADLLDQ*SFRRNF 648 ++E+ G FFV+ V+ + L R + Q FR F Sbjct: 931 FLEWTGYTAFFVSIVVEQLADLIIRKTRRNSVFQQGLFRNKF 972 Score = 43 (19.8 bits), Expect = 37., Sum P(3) = 1.0 Identities = 11/33 (33%), Positives = 19/33 (57%), Frame = +1 Query: 391 IISALREWMAELGKRSSVAVSWIGKVKTTAQMV 489 IISA E + ++ KR ++ V + K + A +V Sbjct: 651 IISAGSETVDDIAKRLNIPVEQVNKREAKAAVV 683 Score = 40 (18.4 bits), Expect = 37., Sum P(3) = 1.0 Identities = 6/12 (50%), Positives = 9/12 (75%), Frame = +3 Query: 162 CHLVAVCRRAHF 197 C +V++C RA F Sbjct: 440 CKIVSLCNRAEF 451
gi|218415 phosphatidylserine synthase Length = 276 Local hits (HSPs): _________ __________________________________________________ Database sequence: | | | | | | | 276 0 50 100 150 200 250 Plus Strand HSPs: Score = 61 (28.1 bits), Expect = 37., P = 1.0 Identities = 16/44 (36%), Positives = 23/44 (52%), Frame = +1 Query: 184 AALIFCVAAVTDWFDGFLARRWNQSTRFGAFLDPVADKVLVAIA 315 A +A D+ DG +AR N+S+ G LD +AD V +A Sbjct: 116 AHFFILLAMCFDFLDGRVARLRNRSSLMGQELDSLADLVSFGVA 159
gi|530088 aminoalcoholphosphotransferase Length = 389 Cluster: 4944.3 aminoalcoholphosphotransferase ethanolaminephosphotransferase saccharomyces cerevisiae ethpt diacylglycerol sn-1 cholinephosphotransferase 2-diacylglycerol chopt Conserved regions: Cluster 4944.3 |_______ ________ _____ _| Local hits (HSPs): _______ __________________________________________________ Database sequence: | | | | 389 0 150 300 Plus Strand HSPs: Score = 61 (28.1 bits), Expect = 39., P = 1.0 Identities = 16/45 (35%), Positives = 19/45 (42%), Frame = +1 Query: 160 PVTWSPFAAALIFCVAAVTDWFDGFLARRWNQSTRFGAFLDPVAD 294 P W FA L+ + D DG ARR N S+ G D D Sbjct: 76 PPRWVHFAHGLLLFLYQTFDAVDGKQARRTNSSSPLGELFDHGCD 120
gi|580702 fixP Length = 293 Cluster: 4770 ccop fixp fixp=membrane-anchored diheme cytochrome symbiotic nitrogen fixation gene cluster Conserved regions: Cluster 4770 |_______ _____ ______ __ __| Local hits (HSPs): __ ____ __________________________________________________ Database sequence: | | | | | | | 293 0 50 100 150 200 250 Plus Strand HSPs: Score = 54 (24.8 bits), Expect = 41., Sum P(2) = 1.0 Identities = 7/8 (87%), Positives = 7/8 (87%), Frame = +2 Query: 473 PLPRWWRW 496 PLPRWW W Sbjct: 34 PLPRWWLW 41 Score = 38 (17.5 bits), Expect = 41., Sum P(2) = 1.0 Identities = 9/21 (42%), Positives = 14/21 (66%), Frame = +2 Query: 809 DLAKVGVASSSLVSRSSLKDI 871 DL K+ ASS+ ++ L+DI Sbjct: 85 DLQKLRAASSAKLANVPLEDI 105
sp|P10327|CRYW_BACTA|gi|117546 130 KD CRYSTAL PROTEIN (DELTA ENDOTOXIN) (CRYSTALINE ENTOMOCIDAL PROTOXIN). Length = 823 Cluster: 198.50 130 parasporal kd protein crystal delta endotoxin crystaline entomocidal protoxin Cluster: 198.53 130 parasporal kd protein crystal delta endotoxin crystaline entomocidal protoxin Conserved regions: Cluster 198.50 |___ ___ _______ ________________| Cluster 198.53 | __ ________| Local hits (HSPs): __ Annotated Domains: ______________________________________ __________________________________________________ Database sequence: | | | | | | | 823 0 150 300 450 600 750 __________________ Annotated Domains: PFAM endotoxin: delta endotoxin 1..616 __________________ Minus Strand HSPs: Score = 61 (28.1 bits), Expect = 42., P = 1.0 Identities = 10/14 (71%), Positives = 11/14 (78%), Frame = -3 Query: 525 PNVRTPQQPCQRHH 484 P +R QQPCQRHH Sbjct: 367 PTLRLLQQPCQRHH 380
gi|490199 lepidoptera larvicidal protein Length = 823 Cluster: 198.50 130 parasporal kd protein crystal delta endotoxin crystaline entomocidal protoxin Cluster: 198.53 130 parasporal kd protein crystal delta endotoxin crystaline entomocidal protoxin Conserved regions: Cluster 198.50 |___ ___ _______ ________________| Cluster 198.53 | __ ________| Local hits (HSPs): __ __________________________________________________ Database sequence: | | | | | | | 823 0 150 300 450 600 750 Minus Strand HSPs: Score = 61 (28.1 bits), Expect = 42., P = 1.0 Identities = 10/14 (71%), Positives = 11/14 (78%), Frame = -3 Query: 525 PNVRTPQQPCQRHH 484 P +R QQPCQRHH Sbjct: 367 PTLRLLQQPCQRHH 380
gi|291529 tegument protein Length = 841 Cluster: 7006.2 positional tegument transcriptional regulator homolog ie63 of protein icp27 ul69 Conserved regions: Cluster 7006.2 | _____ __ _ | Local hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | | | 841 0 150 300 450 600 750 Minus Strand HSPs: Score = 61 (28.1 bits), Expect = 42., P = 1.0 Identities = 17/38 (44%), Positives = 19/38 (50%), Frame = -2 Query: 556 QRKVQYRRTQPKCSDATAAMPTPPSGQWFSLSQSRRRP 443 Q+ Q T K S TAAMP PPS S + RRP Sbjct: 595 QQSQQQPETTSKESSKTAAMPPPPSPCSPSPASRERRP 632
sp|P31287|WNT6_XENLA|gi|401424 XWNT-6 PROTEIN. Length = 129 Cluster: 76.93 wingless wnt-1 wnt-2 wnt-6 wnt-b xwnt-6 gene protein rerio precursor Conserved regions: Cluster 76.93 |________ _____ __________ | Local hits (HSPs): _____________ ___________ Annotated Domains: __________________________________________________ __________________________________________________ Database sequence: | | | | 129 0 50 100 __________________ Annotated Domains: Entrez glycosylation site 92 PFAM wnt: wnt family of developmental signali 1..129 PROSITE WNT1: Wnt-1 family signature. 3..12 __________________ Plus Strand HSPs: Score = 44 (20.2 bits), Expect = 44., Sum P(2) = 1.0 Identities = 10/33 (30%), Positives = 15/33 (45%), Frame = +3 Query: 141 CIGLLSACHLVAVCRRAHFLRRGGD*LVRWFSG 239 C GL +C ++ R GD L+ F+G Sbjct: 5 CHGLSGSCTFTTCWKKMPHFREVGDRLLERFNG 37 Score = 43 (19.8 bits), Expect = 44., Sum P(2) = 1.0 Identities = 9/25 (36%), Positives = 10/25 (40%), Frame = +3 Query: 543 CTFLCGCGTDSVVNVAIFERCACRF 617 C LC V + E C CRF Sbjct: 101 CDLLCCGRGQREETVVVEENCLCRF 125 Parameters: -gi -echofilter H=1 E=50 V=50 B=50 -ctxfactor=6.00 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.319 0.135 0.396 +3 0 BLOSUM62 0.319 0.135 0.396 0.362 0.162 0.608 +2 0 BLOSUM62 0.319 0.135 0.396 0.348 0.151 0.559 +1 0 BLOSUM62 0.319 0.135 0.396 0.341 0.147 0.485 -1 0 BLOSUM62 0.319 0.135 0.396 0.340 0.141 0.447 -2 0 BLOSUM62 0.319 0.135 0.396 0.350 0.152 0.529 -3 0 BLOSUM62 0.319 0.135 0.396 0.333 0.143 0.459 Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 318 318 50. 56 3 12 22 0.10 36 +2 0 318 318 50. 56 3 12 22 0.10 36 +1 0 318 318 50. 56 3 12 22 0.10 36 -1 0 318 318 50. 56 3 12 22 0.10 36 -2 0 318 318 50. 56 3 12 22 0.10 36 -3 0 318 318 50. 56 3 12 22 0.10 36 Statistics: Query Expected Observed HSPs HSPs Frame MatID High Score High Score Reportable Reported +3 0 65 (29.9 bits) 63 (29.0 bits) 9 9 +2 0 65 (29.9 bits) 57 (26.2 bits) 11 11 +1 0 65 (29.9 bits) 945 (434.7 bits) 23 23 -1 0 65 (29.9 bits) 59 (27.1 bits) 5 5 -2 0 65 (29.9 bits) 66 (30.4 bits) 20 20 -3 0 65 (29.9 bits) 61 (28.1 bits) 19 19 Query Neighborhd Word Excluded Failed Successful Overlaps Frame MatID Words Hits Hits Extensions Extensions Excluded +3 0 5118 9567919 1875177 7689369 3373 0 +2 0 6067 9861874 2095365 7760966 5543 5 +1 0 5374 9031376 1875308 7149673 6395 7 -1 0 3767 7828582 1291609 6531023 5950 5 -2 0 4274 9510270 1839648 7663878 6744 51 -3 0 5420 10605557 2059057 8539356 7144 22 Database: /local/dot5/sl_home/beauty/seqdb/blast-db/CRSeqAnnot.fa Release date: unknown Posted date: 4:10 PM CDT Jun 27, 1995 # of letters in database: 28,902,124 # of sequences in database: 78,469 # of database sequences satisfying E: 42 No. of states in DFA: 596 (59 KB) Total size of DFA: 326 KB (384 KB) Time to generate neighborhood: 0.03u 0.01s 0.04t Real: 00:00:00 No. of processors used: 4 Time to search database: 92.89u 0.10s 92.99t Real: 00:00:31
|
||||