BLKPROB Version 8/26/99.1
Database=../data-blplus/blocks.dat
___________ ___________ ___________
|\ __________\ |___________| /__________ /|
| | | | | | | |
| | **********| |***********| |********** | |
| | * BLOCKS | |EMAIL & WWW| |SEARCHER * | |
| | **********| |***********| |********** | |
\|___________|___________|___________|___________|___________|/
|\ __________\ /__________ /|
| | blocks@ | | http:// | |
| | blocks. | | blocks. | |
| | fhcrc. | | fhcrc. | |
| | org | | org | |
\|___________| |___________|/
Here are your search results. The database searched was Blocks+ (10 Oct 99)
which includes: BLOCKS 11.0 consisting of 4034 blocks representing 994 groups
documented in PROSITE 15, plus 2623 blocks from 410 groups documented in
PRINTS 24.0 but not represented in BLOCKS, plus 2041 blocks from 475 groups
documented in PFAM 4.3 but not represented in BLOCKS or PRINTS, plus
1066 blocks from 273 groups documented in PRODOM 99.1 but not represented in
BLOCKS, PRINTS or PFAM, plus 306 blocks from 83 groups documented in DOMO 2.0
but not represented in BLOCKS, PRINTS, PFAM or PRODOM for a total of 10,070
blocks from 2235 groups. Get more information at http://blocks.fhcrc.org.
If you found the Blocks Searcher useful, please cite:
S Henikoff & JG Henikoff, "Protein family classification
based on searching a database of blocks", Genomics 19:97-107 (1994).
Please report problems to: webmaster@blocks.fhcrc.org
==============================================================================
Each hit consists of one or more blocks from a protein group found
in the query sequence. One set of the highest-scoring blocks that are in the
correct order and separated by distances comparable to the Blocks database is
selected for analysis. If this set includes multiple blocks the probability
that the lower scoring blocks support the highest scoring block is reported.
Maps of the database blocks and query sequence are shown:
AAA represents a block roughly in proportion to its width.
: represents the minimum distance between blocks in the database.
. represents the maximum distance between blocks in the database.
< > indicate the sequence has been truncated to fit the page.
The query map is aligned on the highest scoring block. Multiple block hits
that are consistent with the highest scoring block are separated by colons.
Block hits that are not consistent are mapped below. The alignment of the
query sequence with the sequence closest to it in the BLOCKS database is
shown. The distance between detected blocks is listed as (min, max): for the
database entry followed by the distance in the query. Upper case in the query
indicates at least one occurrence of the residue in that column of the block.
=============================================================================
Note: For searches using DNA queries, "Location" refers to the position
in the query in base pairs from 5' to 3' on the + strand, whereas the map and
alignment show the translated position in amino acid residues.
=============================================================================
[Return to top][Return to top] [Blocks Home]Hits
Query=Unknown Unknown Size=503 Amino Acids Blocks Searched=10070 Alignments Done= 5321941 Cutoff combined expected value for hits= 5 Cutoff block expected value for repeats/other= 5 ============================================================================== Anchor Combined Family Strand Blocks E-value E-value BL00933 FGGY family of carbohydrate kinases 1 5 of 5 5.2e-25 8e-67 PF00778 DAX domain 1 1 of 13 2 2 PR00049 Wilm's tumour protein signature 1 1 of 4 2.8 2.8 BL00115 Eukaryotic RNA polymerase II heptap 1 2 of 26 11 3.2 PR00400 Tetracycline repressor protein sign 1 1 of 5 3.5 3.5 PR00234 HIV-1 matrix protein signature 1 1 of 5 3.6 3.5 PF00855 PWWP domain 1 1 of 1 4.4 4.3 BP04234 PRECURSOR AMPHIBIAN SKIN SIGNA 1 1 of 2 4.9 5 ============================================================================== >BL00933 5/5 blocks Combined E-value= 8e-67: FGGY family of carbohydrate kinases proteins. Block Frame Location (aa) Block E-value BL00933A 0 6-29 4.8e-13 BL00933B 0 40-50 0.0009 BL00933C 0 129-148 2.1e-10 BL00933D 0 182-218 5.2e-25 BL00933E 0 411-426 4.2e-09 Other reported alignments: |--- 290 amino acids---| BL00933 AA......B:.......CC::.............DDD::...................E Unknown AA:B:::::::CC:::DDD:::::::::::::::::E BL00933A <->A (0,70):5 GLPK_HAEIN|P44400 5 YIIALDQGTTSSRAVLLDHNANVV |||||||||||||||||||||||| Unknown 6 YIIALDQGTTSSRAVLLDHNANVV BL00933B A<->B (0,75):10 GLPK_HAEIN|P44400 39 YPRAGWVEHNP ||||||||||| Unknown 40 YPRAGWVEHNP BL00933C B<->C (17,93):78 GLPK_HAEIN|P44400 128 TGLVVDPYFSGTKVKWILDN |||||||||||||||||||| Unknown 129 TGLVVDPYFSGTKVKWILDN BL00933D C<->D (26,179):33 GLPK_HAEIN|P44400 181 TDYTNASRTMLFNIHTKQWDDKMLEILNIPRSMLPEV ||||||||||||||||||||||||||||||||||||| Unknown 182 TDYTNASRTMLFNIHTKQWDDKMLEILNIPRSMLPEV BL00933E D<->E (26,241):192 GLPK_HAEIN|P44400 410 GGATNNNFLMQFQADI |||||||||||||||| Unknown 411 GGATNNNFLMQFQADI ------------------------------------------------------------------------------ >PF00778 1/13 blocks Combined E-value= 2: DAX domain Block Frame Location (aa) Block E-value PF00778J 0 134-161 2 Other reported alignments: |--- 270 amino acids---| PF00778 AAA:BBBB::::.....CCC:.....DDDEEEFFGGHHH::..IIJJJKKK:.L:.MMM Unknown ::::::::::::JJJ PF00778J <->J (355,503):133 DSH_DROME|P51140 422 NAFIGADAVNWVLENVEDVQDRREARRI | | | ||| | Unknown 134 dpyfsgtkVkWiLdNVEGarEkaErgel ------------------------------------------------------------------------------ >PR00049 1/4 blocks Combined E-value= 2.8: Wilm's tumour protein signature Block Frame Location (aa) Block E-value PR00049B 0 231-247 2.8 **biased** Other reported alignments: |--- 28 amino acids---| PR00049 AAAAAAAAAAAAAAA:.BBBBBBBBBBBBBBB:CCCCCCCCCCCCCDDDDDDDDDDDDD Unknown <::::::::::::::::BBBBBBBBBBBBBBB PR00049B <->B (19,20):230 Q15881 19 GGGGGCALPVSGAAQWA || || || | | Unknown 231 GGkGGvriPVaGiAgdq ------------------------------------------------------------------------------ >BL00115 2/26 blocks Combined E-value= 3.2: Eukaryotic RNA polymerase II heptapeptide repeat proteins. Block Frame Location (aa) Block E-value BL00115K 0 57-98 2.3e+02 BL00115M 0 148-190 11 Up to 51 repeats expected: Other reported alignments: |--- 941 amino acids---| BL00115 AB:.C:D:EFGH:.IJKL...MN:OPQRS::::.....TUVW::.......XY:::...Z Unknown :K:M BL00115K <->K (499,585):56 RPB1_CAEEL|P16356 514 QLITPQANKPVMGIVQDTLCAVRMMTKRDVFIDWPFMMDLLM | | || | | | | | Unknown 57 QssTlnevvakaGItsDeiAAIgitnqReTtIvWEkstgTpv BL00115M K<->M (47,174):49 RPB1_CAEEL|P16356 612 SPGDTKVIIEHGELLSGIVCSKTVGKSAGNLLHVVTLELGYEI | |||| | | | | || Unknown 148 NvegarekaERGELLFGTVDtwlVwKltqGrVHVtdytnasrt ------------------------------------------------------------------------------ >PR00400 1/5 blocks Combined E-value= 3.5: Tetracycline repressor protein signature Block Frame Location (aa) Block E-value PR00400A 0 231-254 3.5 Other reported alignments: |--- 75 amino acids---| PR00400 AAAAAAAA::::::::::BBBBBBBCCCCCCCC::::DDDDDDD::::::::::..EEEEE Unknown AAAAAAAA PR00400A <->A (20,21):230 TER3_ECOLI|P03039 21 GMEGLTTRRLAERLGVQQPALYWH | | | | || ||| | Unknown 231 GgkGgvripVAgiaGdQQaALYgH ------------------------------------------------------------------------------ >PR00234 1/5 blocks Combined E-value= 3.5: HIV-1 matrix protein signature Block Frame Location (aa) Block E-value PR00234B 0 483-501 3.6 Other reported alignments: |--- 42 amino acids---| PR00234 AAAAAAAAAA:BBBBBBBBBBB:CCCCCCCCCC:::::::DDDDDDDDDDDD.EEEEEEEE Unknown <::::::::::BBBBBBBBBBB PR00234B <->B (21,23):482 Q03259 23 RPKGKKRYLVRHLVWAKKE | || | | | ||| Unknown 483 RyKGwKKavKRsLEWAKed ------------------------------------------------------------------------------ >PF00855 1/1 blocks Combined E-value= 4.3: PWWP domain Block Frame Location (aa) Block E-value PF00855 0 87-103 4.4 Other reported alignments: PF00855 <-> BR14_HUMAN|P55201 1087 DLVWAKCRGYPSYPALI || | | | | | Unknown 87 tIVWeKstGtPvYnAiV ------------------------------------------------------------------------------ >BP04234 1/2 blocks Combined E-value= 5: PRECURSOR AMPHIBIAN SKIN SIGNA Block Frame Location (aa) Block E-value BP04234B 0 473-502 4.9 **biased** Up to 2 repeats expected: Other reported alignments: |--- 80 amino acids---| BP04234 AAAAA:::...........................................BBBBBBBBB Unknown <::::::::::::::::::::::::::::::::::::::::::::::::::BBBBBBBBB BP04234B <->B (25,162):472 MAGA_XENLA|P11006 26 ADEDMDEREVRGIGKFLHSAGKFGKAFVGE | | || | | | | Unknown 473 pDsDNekRERRykGWkkavkrsLewAkedE ------------------------------------------------------------------------------ 8 possible hits reported