HGSC
|
SL Home
|
Search Tools
|
Help
|
FAQ
|
What's New
|
Contact Us
|
Comments
|
User Survey
|
Site Search
Start Search Launcher:
- Nucleic Acid Search
- General Protein Search
- Species Protein Search
- Multiple Sequence Alignment
- Pairwise Sequence Alignment
- Gene Features Searches
- Sequence Utilities
- Protein Structure Prediction
Other Services
- BCM Human Transcript Database
- BCM Gene Finder
- BCM Protein Structure Prediction
Choose a type of search from the pull-down menu
Alignment Result
Alignment performed with LAP2 program at Michigan Tech. Univ. Max Match Min Mismatch Gap-Open Penalty Gap-Extension Penalty 11 -4 10 2 Upper Sequence: Length: 434 Lower Sequence: Length: 434 ********************************************************* Number 1 Local Alignment Similarity Score : 11 DNA Strand : plus Match Percentage : 0% Number of Matches : 0 Number of Mismatches : 10 Total Length of Gaps : 0 Begins at (24, 310) and Ends at (53, 319) 0 . : . : . : 24 TANGVVSRAAVPSGASTGVYEALELRDGGS .. .. . . .... 310 TyrLysThrSerAspPheGlnIleValGly Alternative Display 0 . : . : . : 24 TANGVVSRAAVPSGASTGVYEALELRDGGS .. .. . . .... 310 Y K T S D F Q I V G ********************************************************* Number 2 Local Alignment Similarity Score : 11 DNA Strand : plus Match Percentage : 0% Number of Matches : 0 Number of Mismatches : 18 Total Length of Gaps : 0 Begins at (110, 84) and Ends at (163, 101) 0 . : . : . : . : . : 110 GANAILAVSLAVCKAGASVKKIPLYKHIANLAGNPKLVLPVPAFNVINGGSHAG .. . . ... . . .. . .. . .. 84 AspGlnSerLysValAspGluPheLeuLysLysLeuAspGlySerAlaAsnLys Alternative Display 0 . : . : . : . : . : 110 GANAILAVSLAVCKAGASVKKIPLYKHIANLAGNPKLVLPVPAFNVINGGSHAG .. . . ... . . .. . .. . .. 84 D Q S K V D E F L K K L D G S A N K ********************************************************* Number 3 Local Alignment Similarity Score : 10 DNA Strand : plus Match Percentage : 0% Number of Matches : 0 Number of Mismatches : 12 Total Length of Gaps : 0 Begins at (125, 25) and Ends at (160, 36) 0 . : . : . : . 125 GASVKKIPLYKHIANLAGNPKLVLPVPAFNVINGGS .. . . . . . . . . .... 25 GluThrGlyLeuHisArgAlaIleValProSerGly Alternative Display 0 . : . : . : . 125 GASVKKIPLYKHIANLAGNPKLVLPVPAFNVINGGS .. . . . . . . . . .... 25 E T G L H R A I V P S G ********************************************************* Number 4 Local Alignment Similarity Score : 10 DNA Strand : plus Match Percentage : 0% Number of Matches : 0 Number of Mismatches : 13 Total Length of Gaps : 0 Begins at (140, 149) and Ends at (178, 161) 0 . : . : . : . 140 LAGNPKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA .. . .. .... . . . . .. 149 GlnAsnValLeuAsnGlyGlySerHisAlaGlyGlyArg Alternative Display 0 . : . : . : . 140 LAGNPKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGA .. . .. .... . . . . .. 149 Q N V L N G G S H A G G R ********************************************************* Number 5 Local Alignment Similarity Score : 9 DNA Strand : plus Match Percentage : 0% Number of Matches : 0 Number of Mismatches : 33 Total Length of Gaps : 0 Begins at (62, 65) and Ends at (160, 97) 0 . : . : . : . : . : . : 62 KAVDNVNKIIGPALIGKDATEQTAIDIDFMFQQLDGTVNEWGWCKQKLGANAILAVSLAV . . . ... . . . . . ... .. . 65 GluAsnValAsnLysThrIleAlaProAlaValIleGluGluAsnLeuAspValLysAsp 60 . : . : . : . 122 CKAGASVKKIPLYKHIANLAGNPKLVLPVPAFNVINGGS . . . . . . . ... 85 GlnSerLysValAspGluPheLeuLysLysLeuAspGly Alternative Display 0 . : . : . : . : . : . : 62 KAVDNVNKIIGPALIGKDATEQTAIDIDFMFQQLDGTVNEWGWCKQKLGANAILAVSLAV . . . ... . . . . . ... .. . 65 E N V N K T I A P A V I E E N L D V K D 60 . : . : . : . 122 CKAGASVKKIPLYKHIANLAGNPKLVLPVPAFNVINGGS . . . . . . . ... 85 Q S K V D E F L K K L D G
HGSC
|
SL Home
|
Search Tools
|
Help
|
FAQ
|
What's New
|
Contact Us
|
Comments
|
User Survey